PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC723_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 332aa    MW: 36769.7 Da    PI: 5.93
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC723_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.11.1e-09138187554
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                kr++r   NR +A rs +RK  +i+eLe++v++L++e ++L  +l   + 
  RrC723_p1 138 KRAKRILANRQSAARSKERKARYIQELERRVQSLQTEATTLSAQLTLFQR 187
                9****************************************998876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.1E-16134198IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.909136199IPR004827Basic-leucine zipper domain
PfamPF077161.4E-7136183IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.05E-10138189No hitNo description
Gene3DG3DSA:1.20.5.1702.3E-8138183No hitNo description
CDDcd147031.73E-20139188No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MDDKPDPRPD PNAGSFPSSF HRRSRSDDMS MFMFTNPLIS SSSAAAAPPS SDDLPSDDDL  60
FSSFIDVDSL SSNPSQPISF PNHAAAAFPL SSSTSRPRHR HSNSVDAGCA MYASDEIMDA  120
KKAMPPEKLS ELWSIDPKRA KRILANRQSA ARSKERKARY IQELERRVQS LQTEATTLSA  180
QLTLFQRDTN GLANENTELK LRLQAMEQQA HLRNALNEAL RKEVERMKME TGEISSNSDS  240
YDMGVQQVQY SPSTFMAIPP YHHGSINNGQ DMMQQMRGFN QSRPMEMSNS QSVSEFLQNG  300
RLQGLEISSN NSSSLVKSEG PSLSASESSS AY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013657521.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P45e-84RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A078FME00.0A0A078FME0_BRANA; BnaA08g28740D protein
STRINGBra030663.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135551727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06850.11e-118basic leucine-zipper 52